Send Inquiry

Request To Call Back

Semaglutide Powder

Get a Price/Quote

MOQ : 25 Kilograms

Semaglutide Powder Specification

Particle Size
90% passes through 100 mesh

Boiling point
Not applicable - decomposes

Storage
Store at -20C, protected from light and moisture

Smell
Odorless

Molecular Formula
C187H291N45O59

Melting Point
Not specified (decomposes)

Shelf Life
2 years if properly stored

HS Code
29419090

Molecular Weight
4113.58 g/mol

Poisonous
Not considered poisonous at therapeutic dosage

Color
White to off-white

Solubility
Soluble in water, DMSO, and DMF

Heavy Metal (%)
0.001%

Loss on Drying
5.0%

Structural Formula
(Available on request or in official documentation)

Medicine Name
Semaglutide Powder

Chemical Name
Semaglutide

CAS No
910463-68-2

Type
Active Pharmaceutical Ingredient

Grade
Pharmaceutical Grade

Usage
Used in the treatment of type 2 diabetes and chronic weight management

Purity(%)
99%

Appearance
White to off-white powder

Physical Form
Powder

Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Storage Conditions
Keep container tightly closed at -20C

Bacterial Endotoxins
<0.5 EU/mg

Endotoxin Level
<0.1 EU/g

Residual Solvents
Complies with ICH Q3C guidelines

Recommended Use
For laboratory/research use or formulation in finished dosage forms

Peptide Content
>85%

Packaging Size
Customisable (1g, 5g, 10g vials, etc.)

Semaglutide Powder Trade Information

Minimum Order Quantity
25 Kilograms

FOB Port
ALL india and export

Payment Terms
Cash Advance (CA), Cash in Advance (CID)

Supply Ability
1000 Kilograms Per Week

Delivery Time
7 Days

Sample Available
Yes

Sample Policy
Contact us for information regarding our sample policy

Main Export Market(s)
Asia

Main Domestic Market
All India

About Semaglutide Powder

Experience the ultimate in peptide purity with Semaglutide Powder-now offered at a special rate for a limited time. With a peptide content exceeding 85% and pharmaceutical-grade purity of 99%, this pristine powder stands as the transcendent choice for research and formulation. Each batch complies with ICH Q3C guidelines for residual solvents and boasts extremely low endotoxin levels, ensuring optimal safety. Available in customizable packaging sizes, benefit from a substantial discount while this unrivaled opportunity lasts. Ideal for laboratory use, storage at -20C guarantees pristine preservation.

Semaglutide Powder-Applications & Features

Used as an active pharmaceutical ingredient for chronic weight management and type 2 diabetes, Semaglutide Powder features exceptional solubility in water, DMSO, and DMF. This odorless, white to off-white powder is manufactured and supplied at the highest grade, making it suitable for laboratory research and formulation into finished dosage forms. Its outstanding purity and customizable vial sizes ensure it meets varying research or pharmaceutical demands, becoming synonymous with quality and reliability in scientific settings.

Sample Policy & Payment Terms for Semaglutide Powder

We offer a transparent sample policy, ensuring clients can request a sample of Semaglutide Powder before a larger outlay. Upon order processing, samples are available in convenient vials and delivered with swift transportation. Payment terms are flexible-contact us to discuss options tailored to your procurement needs. Sample availability helps you validate product specifications and quality firsthand, making your purchasing journey both reliable and straightforward.

FAQ's of Semaglutide Powder:

Q: How should Semaglutide Powder be stored to maintain its integrity?

A: Semaglutide Powder should be stored at -20C in a tightly closed container, protected from light and moisture, to preserve its quality and extend its shelf life.

Q: What are the primary uses of Semaglutide Powder in research or laboratory settings?

A: Semaglutide Powder is primarily used for laboratory and research purposes, especially in studies focused on type 2 diabetes management and chronic weight control, or for formulation into finished dosage forms.

Q: When is it best to order Semaglutide Powder for special discounts or rates?

A: The best time to place an order is during limited-time promotional periods when special discounts or exclusive rates are offered, as indicated by current offers or announcements from the supplier.

Q: Where can I request the structural formula or detailed documentation for Semaglutide Powder?

A: Detailed documentation, including the structural formula, can be requested directly from the supplier or found in the official product documentation provided upon order or inquiry.

Q: What is the benefit of the purity and low endotoxin level in this product?

A: High purity (99%) and very low endotoxin levels (<0.1 EU/g) ensure that the product is suitable for sensitive research applications, reducing potential contaminants and supporting reliable scientific results.

Tell us about your requirement