Semaglutide Powder

Get a Price/Quote

Product Details:

Color White to off-white
HS Code 29419090
Shelf Life 2 years if properly stored
Solubility Soluble in water, DMSO, and DMF
Smell Odorless
Melting Point Not specified (decomposes)
Molecular Weight 4113.58 g/mol
Click to view more
Share Your Product:

Request To Call Back Send Inquiry

Semaglutide Powder Price And Quantity

Minimum Order Quantity 25 Kilograms

Semaglutide Powder Product Specifications

Solubility Soluble in water, DMSO, and DMF
Purity(%) 99%
Smell Odorless
Melting Point Not specified (decomposes)
Chemical Name Semaglutide
Shelf Life 2 years if properly stored
HS Code 29419090
Color White to off-white
Medicine Name Semaglutide Powder
Physical Form Powder
Structural Formula (Available on request or in official documentation)
Heavy Metal (%) 0.001%
Appearance White to off-white powder
Loss on Drying 5.0%
Molecular Formula C187H291N45O59
Poisonous Not considered poisonous at therapeutic dosage
Storage Store at -20C, protected from light and moisture
Boiling point Not applicable - decomposes
Grade Pharmaceutical Grade
Particle Size 90% passes through 100 mesh
Molecular Weight 4113.58 g/mol
CAS No 910463-68-2
Usage Used in the treatment of type 2 diabetes and chronic weight management
Type Active Pharmaceutical Ingredient

Packaging Size Customisable (1g, 5g, 10g vials, etc.)
Peptide Content >85%
Bacterial Endotoxins <0.5 EU/mg
Endotoxin Level <0.1 EU/g
Storage Conditions Keep container tightly closed at -20C
Residual Solvents Complies with ICH Q3C guidelines
Recommended Use For laboratory/research use or formulation in finished dosage forms
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Semaglutide Powder Trade Information

FOB Port ALL india and export
Payment Terms Cash Advance (CA), Cash in Advance (CID)
Supply Ability 1000 Kilograms Per Week
Delivery Time 7 Days
Sample Available Yes
Sample Policy Contact us for information regarding our sample policy
Main Export Market(s) Asia
Main Domestic Market All India

Product Description

Experience the ultimate in peptide purity with Semaglutide Powder-now offered at a special rate for a limited time. With a peptide content exceeding 85% and pharmaceutical-grade purity of 99%, this pristine powder stands as the transcendent choice for research and formulation. Each batch complies with ICH Q3C guidelines for residual solvents and boasts extremely low endotoxin levels, ensuring optimal safety. Available in customizable packaging sizes, benefit from a substantial discount while this unrivaled opportunity lasts. Ideal for laboratory use, storage at -20C guarantees pristine preservation.

Semaglutide Powder-Applications & Features

Used as an active pharmaceutical ingredient for chronic weight management and type 2 diabetes, Semaglutide Powder features exceptional solubility in water, DMSO, and DMF. This odorless, white to off-white powder is manufactured and supplied at the highest grade, making it suitable for laboratory research and formulation into finished dosage forms. Its outstanding purity and customizable vial sizes ensure it meets varying research or pharmaceutical demands, becoming synonymous with quality and reliability in scientific settings.

Sample Policy & Payment Terms for Semaglutide Powder

We offer a transparent sample policy, ensuring clients can request a sample of Semaglutide Powder before a larger outlay. Upon order processing, samples are available in convenient vials and delivered with swift transportation. Payment terms are flexible-contact us to discuss options tailored to your procurement needs. Sample availability helps you validate product specifications and quality firsthand, making your purchasing journey both reliable and straightforward.

FAQ's of Semaglutide Powder:

Q: How should Semaglutide Powder be stored to maintain its integrity?

A: Semaglutide Powder should be stored at -20C in a tightly closed container, protected from light and moisture, to preserve its quality and extend its shelf life.

Q: What are the primary uses of Semaglutide Powder in research or laboratory settings?

A: Semaglutide Powder is primarily used for laboratory and research purposes, especially in studies focused on type 2 diabetes management and chronic weight control, or for formulation into finished dosage forms.

Q: When is it best to order Semaglutide Powder for special discounts or rates?

A: The best time to place an order is during limited-time promotional periods when special discounts or exclusive rates are offered, as indicated by current offers or announcements from the supplier.

Q: Where can I request the structural formula or detailed documentation for Semaglutide Powder?

A: Detailed documentation, including the structural formula, can be requested directly from the supplier or found in the official product documentation provided upon order or inquiry.

Q: What is the benefit of the purity and low endotoxin level in this product?

A: High purity (99%) and very low endotoxin levels (<0.1 EU/g) ensure that the product is suitable for sensitive research applications, reducing potential contaminants and supporting reliable scientific results.

Tell us about your requirement

Price:

Quantity

Select Unit

50
100
200
250
500
1000+

Additional detail

Mobile number

Other Products in 'Active Pharmaceutical Ingredients (API)' category

Caffeine IP BP USP EP Minimum Order Quantity : 100 Type : Other, Active Pharmaceutical Ingredient Taste : Bitter Usage : Pharmaceuticals Ph Level : ~7 (neutral) CAS No : 58082 Molecular Weight : 194.19 g/mol Particle Size : Fine Powder Storage : Other, Store in a cool, dry place Grade : Other, IP/BP/USP/EP EINECS No : 2003621 Poisonous : Other, NonPoisonous Appearance : White Crystalline Powder Loss on Drying : Max 0.5% Molecular Formula : C8H10N4O2 Heavy Metal (%) : Max 0.001% Structural Formula : C8H10N4O2 Physical Form : Powder Medicine Name : Caffeine IP BP USP EP Color : White Shelf Life : 5 Years HS Code : 29393000 Chemical Name : 1,3,7Trimethylxanthine Melting Point : 235C Smell : Other, Odourless Purity(%) : 99.0% Min Solubility : Soluble in water and chloroform Boiling point : 178C (Sublimates)

Send Inquiry

Amodiaquine HCL USP Minimum Order Quantity : 100 Type : Other, Active Pharmaceutical Ingredient (API) Taste : Bitter Usage : Antimalarial drug; pharmaceutical formulation Ph Level : 4.5 6.5 (1% solution) CAS No : 6398987 Molecular Weight : 466.79 g/mol Particle Size : 90% passes through 100 mesh Storage : Other, Store in a cool, dry, wellventilated area in tightly closed original container, protected from light Grade : Other, USP EINECS No : 2280129 Poisonous : YES Appearance : Yellow crystalline powder Loss on Drying : NMT 0.5% Molecular Formula : C20H22ClN3O2HCl Heavy Metal (%) : NMT 0.001% Structural Formula : C20H22ClN3O2HCl (structure available upon request) Physical Form : Solid Medicine Name : Amodiaquine HCL USP Color : Yellow Shelf Life : 5 years HS Code : 29334900 Chemical Name : 4[(7Chloroquinolin4yl)amino]2(diethylaminomethyl)phenol dihydrochloride Melting Point : 220C (decomposes) Smell : Other, Odorless Purity(%) : = 99.0 Solubility : Soluble in water and methanol Boiling point : Not applicable (decomposes before boiling)

Send Inquiry

Azithromycin api powder Minimum Order Quantity : 10 Type : Other, Antibiotic Active Pharmaceutical Ingredient (API) Taste : Bitter Usage : Used in the formulation of oral and injectable antibiotics for bacterial infection treatment Ph Level : 5.0 7.5 (1% aqueous solution) CAS No : 83905015 Molecular Weight : 749.0 g/mol Particle Size : NMT 10 microns (90% passing) Storage : Other, Store in a cool, dry, wellventilated area below 25C, protected from light and moisture Grade : Other, Pharmaceutical Grade EINECS No : 6175005 Poisonous : Other, Nonpoisonous under prescribed use Appearance : White to offwhite crystalline powder Loss on Drying : Not more than 5.0% Molecular Formula : C38H72N2O12 Heavy Metal (%) : Not more than 20 ppm Structural Formula : (available upon request or refer to product documentation) Physical Form : Powder Medicine Name : Azithromycin API Powder Color : Other, White to offwhite Shelf Life : 5 years if properly stored in unopened containers HS Code : 29419090 Chemical Name : Azithromycin Melting Point : 113C to 115C Smell : Other, Odorless Purity(%) : 98.0% to 102.0% Solubility : Soluble in methanol, slightly soluble in water, practically insoluble in hexane Boiling point : Not applicable (decomposes before boiling)

Send Inquiry

Amodiaquine HCL USP Minimum Order Quantity : 100 Type : Other, Active Pharmaceutical Ingredient (API) Taste : Bitter Usage : Antimalarial drug; used for the treatment of malaria Ph Level : 4.0 6.0 (1% solution) CAS No : 6398987 Molecular Weight : 464.8 g/mol Particle Size : Micronized Storage : Other, Store in a dry, cool place. Protect from light and moisture. Grade : Other, USP EINECS No : 2289047 Poisonous : YES Appearance : Yellow crystalline powder Loss on Drying : 1.0% Molecular Formula : C20H22ClN3O2HCl Heavy Metal (%) : 0.001% Structural Formula : C20H22ClN3O2HCl (as per image structure) Physical Form : Solid Medicine Name : Amodiaquine HCL USP Color : Yellow Shelf Life : 5 years HS Code : 2933.49 Chemical Name : 4[(7Chloroquinolin4yl)amino]2(diethylaminomethyl)phenol dihydrochloride Melting Point : 215221C Smell : Other, Odorless Purity(%) : 98.0% Solubility : Freely soluble in water, sparingly soluble in alcohol

Send Inquiry

SEND INQUIRY CALL ME FREE